Biology
12th Edition
ISBN: 9780134813448
Author: Audesirk, Teresa, Gerald, Byers, Bruce E.
Publisher: Pearson,
expand_more
expand_more
format_list_bulleted
Question
Chapter 13.5, Problem 1HYEW
Summary Introduction
To explain:
Why bruises turn colors.
Introduction:
Bruises are a discoloration and tenderness of the skin caused by the leakage of the blood cells from a ruptured blood vessel into the tissues. A small bruise is called the ‘petechia’. When a bruise becomes a disease, it is called ‘purpura’.
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solutionStudents have asked these similar questions
Gene Expression and the Impact of a Mutation.
Can someone help me to answer the question 8 and 9, please?
8. How has the mutation altered the polypeptide? Is the function of the hemoglobin molecule (which includes 2 ẞ-globin polypeptides and 2 a-globin polypeptides) impaired? (Read your book to learn more about sickle cell disease.)
9. What is the relationship between the genotype in this case and the individual's phenotype?
asap please
sickle hemoglobin when deoxygenated will create a long line of protein cells? is this true?
Please explain your answer. thanks
In denaturation of DNA and protein explain how denaturation brings about the ailment and what its effect in our body.
Chapter 13 Solutions
Biology
Ch. 13.1 - describe three types of RNA that play roles in...Ch. 13.1 - Prob. 2CYLCh. 13.1 - Prob. 3CYLCh. 13.2 - Prob. 1TCCh. 13.2 - Prob. 1CYLCh. 13.2 - Prob. 2CYLCh. 13.2 - describe an example of post-transcription...Ch. 13.3 - Prob. 1TCCh. 13.3 - Prob. 1CSCCh. 13.3 - Prob. 1CYL
Ch. 13.3 - Prob. 2CYLCh. 13.3 - Prob. 3CYLCh. 13.3 - Prob. 4CYLCh. 13.4 - Prob. 1CSCCh. 13.4 - describe three different types of mutations?Ch. 13.4 - Prob. 2CYLCh. 13.5 - Prob. 1HYEWCh. 13.5 - Envision yourself as a physician. A mother,...Ch. 13.5 - Prob. 2TCCh. 13.5 - Prob. 1CYLCh. 13.5 - Prob. 2CYLCh. 13.5 - Prob. 3CYLCh. 13.5 - Prob. 4CYLCh. 13.5 - Prob. 1CTCh. 13 - Prob. 1MCCh. 13 - Which of the following is not true of RNA? a. It...Ch. 13 - Prob. 3MCCh. 13 - Prob. 4MCCh. 13 - Prob. 5MCCh. 13 - Synthesis of RNA from the instructions in DNA is...Ch. 13 - Prob. 2FIBCh. 13 - Prob. 3FIBCh. 13 - Prob. 4FIBCh. 13 - Prob. 5FIBCh. 13 - If a nucleotide is replaced by a different...Ch. 13 - Prob. 1RQCh. 13 - Name the three types of RNA that are essential to...Ch. 13 - Prob. 3RQCh. 13 - Prob. 4RQCh. 13 - Prob. 5RQCh. 13 - Prob. 6RQCh. 13 - Prob. 7RQCh. 13 - Define mutation. Describe four different effects...Ch. 13 - Prob. 1ACCh. 13 - Prob. 2AC
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- The distal histidine stabilises the iron in heme group of a deoxyhaemoglobin. T/Farrow_forwardSickle cell anemia patients suffer from a distorted red blood cell shape and an anemic condition as a result of a genetic mutation in the HBB gene, which codes for the hemoglobin β subunits. This mutation changes a Glu to a Val at position 6 in the protein, and these patients express two alleles (one from each parent) with this mutation. When individuals inherit just one copy of this mutated gene, they are considered carriers, and have very few symptoms. Based on the quaternary structure of hemoglobin, what can you predict about the assembly of hemoglobin in sickle cell anemia patients versus carriers of the sickle cell trait? a. In sickle cell anemia patients, the α globin subunits have complementary mutations to ensure the quaternary structure of hemoglobin is attained. b. In sickle cell anemia patients, 100% of the hemoglobin is fully functional, whereas in those that carry the trait, there is no functional hemoglobin assembled. c. In individuals with the sickle cell…arrow_forwardPls send me answer of this question briefly i will give you like sure sir • You and your roommate are watching the track and field events at the Olympics. One of the sportscasters mentions that a particular athlete has been banned from competing because he was found guilty of blood doping. Your roommate asks you what blood doping is and why the athlete would be banned for doping his blood. How would you answer your roommates’ question?arrow_forward
- alpha-globin in cow and pigarrow_forwardCyclin B and_ and degraded by active APC/C. Lare ubiquitylatedarrow_forwardAlbinism (achromia) is a genetic condition in which an individual cannot synthesize melanin from tyrosine (an amino acid), a brown pigment of the hair, skin, and eyes. These individuals lack whar?arrow_forward
- Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas , show the amino acid area with the mutation.Lasltyly describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"arrow_forwardA man feels a shooting pain in his arm, then a thundering in his chest. Realizing that he is in the throes of a heart attack, he reaches for his self-injector of tPA (tissue plasminogen activator) and quickly injects himself. The tPA begins to break apart the blood clots that are blocking his heart’s circulation. This lifesaving protein is naturally found in the human body in tiny amounts. The man’s tPA drug, although identical to his own, was manufactured in bacteria. a. How is it possible for bacteria to express protein that was coded for by a human gene? b. Due to certain advances in biotechnology, it became much cheaper to produce tPA. What DNA technology made it possible to produce large quantities of this protein in bacterial cells?arrow_forwardOne example of a DNA virus (a virus that uses DNA, not RNA, as its genetic material) that causes tumors is human papillomavirus (HPV). Do some research and explain how HPV inactivates the RB protein and indicate with which type(s) of cancer it is associated. Don’t forget to cite your sources.arrow_forward
- Immune System (A&P II) In humans, the mother's antibodies do not cross from the baby's gut into the bloodstream. Yet human breast milk contains antibodies and does protect against intestinal infections. Discuss how these antibodies might work.arrow_forwardhow the clustering of hemoglobin genesimpacts the cellular strategy to regulate expression.arrow_forwardExample of protective proteinsarrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Biology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStaxHuman Physiology: From Cells to Systems (MindTap ...BiologyISBN:9781285866932Author:Lauralee SherwoodPublisher:Cengage LearningHuman Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage Learning
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
Human Physiology: From Cells to Systems (MindTap ...
Biology
ISBN:9781285866932
Author:Lauralee Sherwood
Publisher:Cengage Learning
Human Heredity: Principles and Issues (MindTap Co...
Biology
ISBN:9781305251052
Author:Michael Cummings
Publisher:Cengage Learning
QCE Biology: Introduction to Gene Expression; Author: Atomi;https://www.youtube.com/watch?v=a7hydUtCIJk;License: Standard YouTube License, CC-BY