Using an arrow, draw the site of cleavage for the following peptide that is reacted by: Pepsin (a-b), trypsin (c-d), and chymotrypsin (e) H₂N SH H -NH₂ H PEPTIDE ACWNEG H
Q: 1. What reagent will not denature protein? A. Sulphosalicylic acid B. Copper (II) sulfate C. Nitric…
A: - Protein denaturation involves the disruption and potential destruction of both secondary and…
Q: What is the net charge on the peptide RHTLE at pH 12.5?
A: Net charge of a peptide is calculated by adding the charges of individual amino acids in the…
Q: which two amino acid have two chiral center? I know Isoleucine contain two chiral center,how about…
A: Proteins are composed of amino acids. They are linked together by peptide linkages. Proteins have…
Q: Which lipoprotein removes lipid plaques from blood vessels? A.VLDL B.HDL C.LDL D.chylomicron
A:
Q: Chemistry The soybean-like plants on planet 20170113 also have a globular heme-containing protein…
A: Alpha helix is a regular secondary structure formed by proteins. Each turn of an alpha helix is 5.4…
Q: Show where trypsin and chymotrypsin would cleave the following peptide.…
A: Note: Hi! Thank you for the question. We are authorized to answer one question at a time. Since you…
Q: Draw the structural formula of Tyrosine. Label the carboxyl group, amino group, and R group, and…
A: Proteins are made up of amino acids and these amino acids are linked via peptide bond. The amino…
Q: 3. Precipitation of proteins from aqueous solutions is caused by: A. Appearance of the charge of…
A: Proteins are polymers of amino acids. Therefore they are soluble in water as most of the amino acids…
Q: What is the major difference between motifs and domains? a) Motifs are unstable on their own, while…
A: Motifs and domains are the structural elements of proteins that differ in their organisation and…
Q: Write TRUE or FALSE. If false, write the word/s that make(s) the statement incorrect. 1. ATP is…
A: ATP is required for initiation of transcription as well as serves as one of the four monomers for…
Q: In the glyoxylate cycle, isocitrate is converted directly to what substance? a.fumarate…
A: The glyoxylate cycle takes place is bacteria, fungi , plants and protista. It can be described as…
Q: Histidine is an amino acid with three ionizable groups, one of which has a pKa of 6.0. This group,…
A: pKa of an amino acid changes with a change in PH of the medium. An amino acid has three groups…
Q: Which statement about the ETC is/are FALSE?
A: ETC or the electron transport chain is a collection of protein complexes and other molecules bounded…
Q: What are the charges of the following amino acids peptides at ph 14? 1. GLAVV 2. RRKKQ
A: Peptide chain is a short chain of amino acids joined by peptide/amide bonds (covalent bond). The…
Q: Summarize the general characteristics of carbohydrates.
A: Carbohydrates are the chemically polyhydroxy-aldehydes or polyhydroxy-ketones. They are one of the…
Q: Question:- What is the standard state ∆G^(°') of the complete oxidation of the acetyl group in…
A: G is known as the gibbs free energy. The change in the free energy(∆G)of any reaction causes to…
Q: The phosphate groups in the sugar-phosphate backbone of each strand of a DNA molecule have a pKa of…
A: A DNA molecule is a strand of polynucleotides, where each nucleotide consists of a phosphate group,…
Q: Predict the amino acid sequence based on the conditions below. Use the one-letter abbreviation of…
A: Amino acids are building block of polypeptide chain. its alpha carbon contains carboxyl group, amine…
Q: Draw the peptide SMILE @ pH = 5. What is the net charge? What is the PI?
A: A peptide is a sequence of amino acids that are joined together through peptide bonds. The…
Q: What is a codon, how many RNA nucleotides are in a codon, How many of these code for amino acids,…
A: Transcription is the process by which the genetic information stored in the DNA is copied onto an…
Q: Draw all three structures in the mutarotation equilibrium of (a) d-gulopyranose and also of (b) d-…
A: Before getting into the final answer lets familiarize some of the terms used in this question…
Q: Which of the following is an example of a secondary active transport? a. CPT-I b. O2 pump c.…
A: Transport across the plasma membrane is classified as passive and active. Passive transport is the…
Q: Which peptide has a larger pI? Arg-Gly-Gly-Gly or Gly-Gly-Gly-Arg why?
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: Which of the following 1-C unit:carrier pairing is/are correct? a.biotin:C02 b.THF:-CH2-…
A: Biotin is a co-factor that carries CO2 and regulates the activities of enzymes like acetyl-CoA…
Q: Why does the velocity reach a plateau (asymptote) at high substrate concentrations? a. At high…
A: Introduction Enzymes are known as biocatalyst. They increase rate of a chemical reaction by reducing…
Q: 8) Draw a two-stranded, antiparallel ß-sheet with at least four amino acids in each B-strand.
A:
Q: The C3 pathway can occur in which of the following plants? A. cypresss B.cactus C.banana…
A: The major proportion of plants produce 3-carbon 3-phosphoglyceric acid as a first product during the…
Q: Cardiolipin is a membrane lipid found in bacteria and it is a major component of the inner membranes…
A: Cardiolipin (CL) is a complex phospholipid which is exclusively located in mitochondria. This…
Q: write a short note on 6-mercaptopurin (purin based antimetabolite )its mechanism of action with the…
A: Purine is a heterocyclic aromatic organic compound. Purine is formed by the fusion of two rings.…
Q: Select two molecules that could be found in a protein, and from the two molecules, are they lower or…
A: Proteins are biomolecules composed of amino acids. Amino acids are joined together through peptide…
Q: the structural differences between fatty acids (cis and trans double bonds), diacylglycerols,…
A: Lipids are biomolecule which is soluble in non-polar solvents and insoluble in polar solvents.…
Q: Which of the following is not found within the cytoplasm of a cell? a) Plasma membrane b) Cytosol…
A:
Q: HOw do I plot on michealis Menten plot and a lineweave burk plot and how do I solve the Km and vmax…
A: Michaelis-Menten plot is a representation of substrate concentration [S] with the velocity of an…
Q: In most cases the peptide bond is in the trans conformation. What statement below best explains this…
A: In proteins the adjacent amino acids are held together via peptide bonds . A peptide bond is an…
Q: hich of the following disease is due to wrong amino acid sequence in the 1° level of structure?…
A: Introduction: Proteins are abundant biological molecules in the living system and nearly…
Q: what is the Vmax and Km of the enzyme in the reaction
A: Parameters such as Km and Vmax are used for comparing enzyme activities. If we know the initial rate…
Q: Lysine is degraded to acetoacetyl-CoA then to acetyl-CoA, and is described as a _______ amino…
A: Lysine and arginine are broken down into acetoacetyl CoA and Acetyl CoA respectively. The process…
Q: "Nucleotides are the Subunits of DNA and RNA". Discuss and what lessons can be learn to this.
A: The complete hydrolysis of chromosomal nucleic acid yields inorganic phosphate, 2-deoxyribose and…
Q: Why cannot amylopectin be fully degraded by amylose alone?
A: Carbohydrates are polyhydroxy aldehydes or ketones. Depending on their size, they can be…
Q: Explain why these two DNA samples give different results, when they're both 50% G-C. Fraction of DNA…
A: We know that E. coli is a prokaryote and Potoroo is an eukaryotic animal. The stability of DNA is…
Q: Cyanide binds to and blocks the action of cytochrome oxidase which is the last cytochrome in the…
A: Cyanide is toxic substance which blocks the action of cytochrome oxidase in the electron transfer…
Q: Calculate the amount of ATP that can be produced from one molecule of 8:0 fatty acid metabolized…
A: 8:0 fatty acid means its a 8 carbon saturated fatty acid with no carbon-carbon double bond. A 8:0…
Q: charge? Draw the side chain of arginine in the conjugate acid form and conjugate base form. Which…
A:
Q: RNA polymerase subunits comprising the core enzyme are a.α b.β c.δ d.σ e.ω
A: RNA POLYMERASE It is a multi-subunit enzyme. It is composed of five subunits…
Q: The following data describe the catalysis of cleavage of peptide bonds in small peptides by a…
A: Enzymes are highly specialized proteins that have extraordinary catalytic power, greater than that…
Q: Which of the following processes is described in the reaction shown in the picture?…
A: The enzyme glutamate dehydrogenase catalyzes a reaction in which ammonium ion directly combines with…
Q: Which of the following statement(s) is/are FALSE for hemoglobin? A Demonstrates positive…
A: Hemoglobin is a protein that transports oxygen from lungs to the tissues and CO2 from tissues to the…
Q: 7. The surgeon used a 70% solution of ethyl alcohol to treat the hands before surgery. What is the…
A: 70% ethyl alcohol is used to sanitize the hands and hence, is used by the surgeon before the…
Q: How can Nestle company help in fighting the obesogenic environment in Mexico with their food…
A: Mexico is the second most obesity affected country in the world.More than half of its youngsters and…
Q: Kindly answer the following questions. What is an enzyme? How enzymes are being classified and…
A: - An enzyme is a type of biological catalyst that is often a protein but can also be RNA. - In…
Step by step
Solved in 4 steps with 3 images
- Using an arrow, draw the site of cleavage for the following peptides that are reacted by trypsinYou have isolated this peptide. AÇQGRKSPWTT TAHEVYPGGČMN What products would you get if you treated with: a) DTT ( dithiothreitol) b) Trypsin c) Carboxypeptidase A ( 1 cycle) d) Aminopeptidase M ( 2 cycles) e) DTT, then Iodoacetate, then elastaseDraw the peptide at a pH @1 of Cys-His-Glu-Met-Ile-Ser-Thr-Arg-Tyr
- H CH₂ H₂C HC-CH3 CH₂ H H₂C (S) H₂C H CH₂ CH₂ CH₂ NH O C NH NH₂ a) Which of the following statements about this peptide are correct? Group of answer choices Treatment of this peptide with trypsin generates two products. This peptide is a substrate for carboxypeptidase A Treatment of this peptide with cyanogen bromide generates a pentapeptide and a tripeptide. Treatment of this peptide with chymotrypsin generates three products. Treatment of this peptide with elastase generates 2 products. None of the above statements are correct. b) What is the sequence of this peptide using one letter abbreviations? c) What is the pH which would correspond to the ionization of the peptide as drawn above? 1, 5, 7, 10, 14Show the peptides that would result from cleavage by the indicated reagent: a. Val-Arg-Gly-Met-Arg-Ala-Ser by carboxypeptidase A b. Ser-Phe-Lys-Met-Pro-Ser-Ala-Asp by cyanogen bromide c. Arg-Ser-Pro-Lys-Lys-Ser-Glu-Gly by trypsinThree polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG2. GPYFGDEPLDVHDEPEEG3. PHLLSAWKGMEGVGKSQSFAALIVILAOf the three, which one would migrate most slowly during chromatography through:(a) an ion-exchange resin, beads coated with positively charged groups?(b) an ion-exchange resin, beads coated with negatively charged groups?(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?
- Read very carefully: Chymotrypsin cleaves peptides C TERMINUS to the aromatic amino acids. Trypsin cleaves peptides C TERMINUS to basic amino acids. Cyanogen bromide (CNBR) cleaves C-terminus to methionine residues. With this knowledge, reconstruct the following cleavage products and give the original peptide sequence. CNBR Chymotrypsin WITHHERISALLRIGHT ISTRYWITHM Trypsin EISAM YWITHMEISAMANINGCHEMI STR YWITHHER 1 The which convorted e Name.Use an arrow to draw the site for cleavage for the following peptides reacted by trypsin. Explain comprehensively.The following digestion procedures were performed to determine the peptide sequence of an unknown protein: Step 1. Chymotrypsin: Glu-Leu-Glu-Asp-Tyr; Cys-Ser-Val-Cys; Ser-Leu-Tyr Step 2. Pepsin: Ser-Leu; Tyr-Cys-Ser-Val-Cys; Tyr-Glu-Leu-Glu-Asp What is the sequence of the peptide?
- Subjecting this peptide to trypsin would result in L-M-F-V-W-E-Q-A-P-S-P O A. Lys and Met-Phe-Val-Trp-Glu-Gln-Arg and Pro-Ser-Pro OB, Leu-Met-Phe-Val-Trp-Glu-Gin-Ala-Pro-Ser-Pro Leu and Met-Phe-Val-Trp-Glu-Gln-Arg-Pro-Ser-Pro OC. Op. Lys and Met-Phe-Val-Trp-Glu-Gln-Ala-Pro-Ser-Pro Leu and Met-Phe-Val-Trp-Glu-Gin-Arg-Pro-Ser-Pro OE.A small protein has a sequence ACNCKAAPMLCARYCAMLH. The structure of this single peptide is stabilized by the formation of two separate disulfide bonds, but the locations of those disulfide bonds are unknown. In order to determine the location, you purify this peptide and treat it with trypsin (cleaves peptide bond at long, positively-charged side chains). Tryptic digestion generated two peptides. Based on this result, determine the location of the –S-S– bonds. Show them in a diagram on the sequence by connecting the corresponding residues. Explain your reasoning.Three polypeptides, the sequences of which are represented using the one-letter code for their amino acids, are present in a mixture: Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3: PHLLSAWKGMEGVGKSQSFAALIVILA Determine which peptide would migrate most slowly during the given methods of chromatography. anion exchange chromatography Answer Bank Peptide 1 Peptide 2 Peptide 3 cation exchange chromatography size-exclusion (gel-filtration) chromatography